PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA02G34030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 283aa    MW: 29063.4 Da    PI: 8.9306
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA02G34030.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.4e-3942101362
           zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       +a+kcprC+stntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s 
  ONIVA02G34030.1  42 PEAVKCPRCESTNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRSG 101
                      5789****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-333499IPR003851Zinc finger, Dof-type
PfamPF027013.4E-334499IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4414599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MQEFQSIPGL AGRLFGGAAA ADIRRAQAQQ GPASRCGGIP SPEAVKCPRC ESTNTKFCYY  60
NNYNLSQPRH FCKSCRRYWT KGGVLRNVPV GGGCRKTKRS GSSSAASSAP STPTAATDNA  120
KNQRRASASS PRSSSGGSGN TSPTAAAATT PTTPATPSSN TIAVINHATT TTTTTTNPFP  180
TDVPPPAPIF ADQAAALASL FAPPPPPPLP VFSFAAQAKT EDGIASVLLA GQTTAPTAAT  240
VADMTPFTSL DAGIFELGDV PPAAYWNAGS CWTDVPDPNV YLP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623188.11e-144PREDICTED: dof zinc finger protein MNB1A
TrEMBLA0A0E0GCK10.0A0A0E0GCK1_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NKD60.0A0A0E0NKD6_ORYRU; Uncharacterized protein
STRINGBGIOSGA005698-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.15e-34OBF binding protein 4